PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn103181
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ARR-B
Protein Properties Length: 685aa    MW: 75117.6 Da    PI: 6.4248
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn103181genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.38.3e-29214267155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Achn103181 214 KPRVVWSVELHQQFVAAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 267
                 79*******************.********************************8 PP

2Response_reg75.42.2e-25361441109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+p+ +++l+++l++  y ev+ +  +e al ll+e++  +D+++ D+ mp+mdG++ll++   e  +lp+i+++a ++++ + + +  Ga 
    Achn103181  36 VLVVDDDPTCLMILEKMLRNCLY-EVTKCNRAEIALSLLRENKngFDIVISDVHMPDMDGFKLLEHVGLEM-DLPVIMMSADDSKSVVMKGVTHGAC 130
                   89*********************.***************999999**********************6644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +e+l++
    Achn103181 131 DYLIKPVRIEALRN 144
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.0E-18310675IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23008.8E-4233186No hitNo description
SuperFamilySSF521725.83E-3533158IPR011006CheY-like superfamily
SMARTSM004488.7E-3034146IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.53935150IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-2236144IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.17E-2637149No hitNo description
PROSITE profilePS5129411.048211270IPR017930Myb domain
SuperFamilySSF466893.76E-20211271IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-30213272IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-25214267IPR006447Myb domain, plants
PfamPF002499.8E-8216266IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0010119Biological Processregulation of stomatal movement
GO:0010150Biological Processleaf senescence
GO:0071368Biological Processcellular response to cytokinin stimulus
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MNFGVQGEKS MSMPSSSASW KCGDGVSDHF PVGLRVLVVD DDPTCLMILE KMLRNCLYEV  60
TKCNRAEIAL SLLRENKNGF DIVISDVHMP DMDGFKLLEH VGLEMDLPVI MMSADDSKSV  120
VMKGVTHGAC DYLIKPVRIE ALRNIWQHVV RKRKHEWKDL EQSGSIEDGD REQKPSEDAD  180
FSSSANEGSW RNSKRRKDEE DQAEERDDSS TLKKPRVVWS VELHQQFVAA VNQLGIDKAV  240
PKKILELMNV PGLTRENVAS HLQKYRLYLR RLSGVSQHPG GLNNSFMGPP ETPFGSISSL  300
NGLDLQAFAA AGQLPAQSLA TLEAAALGRS TTKSGISMPF MDQRNLFSFE NPKLRFRDSQ  360
QPQLGNNNKQ MNLLHGIPTN MEPKQLANLH QSAQSSFRGM NMQPNSNPHG SQSSSLLMQM  420
SQPPSRPQMF NDIKRNHLSR LPSSIAQPTL PSGMGSGVLA RHGMVENARG AIYNSASQAS  480
TMVDFSINQN TDLPGNGFQL ANNAGGQMPT VTSKGLLQEE VNSEMKGSRG FAHSYDIFSE  540
LQQHKSQDWG LPNVGLTFDA SQHSNMRSGL DVPPSVLVQQ GFSSNKSNVQ NRSTPFGKAI  600
FLAAEESGCG NGLNIGQQLD TLLAGNSLRV KAESLPEASC QNTLFHEQYS QEDLMSALLK  660
QQEGVGPASN EFGFDGYALD NLPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-22213273464ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00054PBMTransfer from AT4G16110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010649546.10.0PREDICTED: two-component response regulator ARR1 isoform X2
SwissprotQ9ZWJ90.0ARR2_ARATH; Two-component response regulator ARR2
TrEMBLA0A068TS710.0A0A068TS71_COFCA; Uncharacterized protein
STRINGVIT_05s0077g01480.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31912450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.10.0response regulator 2